Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.110: DTD-like [69499] (1 superfamily) beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC |
Superfamily c.110.1: DTD-like [69500] (3 families) active form is a dimer |
Family c.110.1.2: Archaea-specific editing domain of threonyl-tRNA synthetase (Pab-NTD) [310661] (2 proteins) Pfam PF08915 |
Protein automated matches [310853] (2 species) not a true protein |
Species Pyrococcus abyssi [TaxId:29292] [311214] (5 PDB entries) |
Domain d3pd3a_: 3pd3 A: [306228] automated match to d1y2qa_ protein/RNA complex; complexed with a3t |
PDB Entry: 3pd3 (more details), 1.86 Å
SCOPe Domain Sequences for d3pd3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pd3a_ c.110.1.2 (A:) automated matches {Pyrococcus abyssi [TaxId: 29292]} mrvllihsdyieyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka ieeiskvaeqvkaenvfvypfahlsselakpsvamdilnrvyqglkergfnvgkapfgyy kafkisckghplaelsrtivpeear
Timeline for d3pd3a_: