SCOP 1.71: Domain d1kifb1: 1kif B:1-194,B:288-339

Lineage for d1kifb1 (1kif B:1-194,B:288-339)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families)
   this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains

5. Family c.4.1.2: D-aminoacid oxidase, N-terminal domain [51979] (1 protein)
   This family is probably related to the FAD-linked reductases and shares with them the C-terminal domain fold

6. Protein D-aminoacid oxidase, N-terminal domain [51980] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51981] (6 PDB entries)

8. Domain d1kifb1: 1kif B:1-194,B:288-339 [30622]
   Other proteins in same PDB: d1kifa2, d1kifb2, d1kifc2, d1kifd2, d1kife2, d1kiff2, d1kifg2, d1kifh2

Details for d1kifb1

PDB Entry: 1kif, 2.6 Å

PDB Description: d-amino acid oxidase from pig kidney

SCOP Domain Sequences for d1kifb1:

Sequence; same for both SEQRES and ATOM records:

>d1kifb1 c.4.1.2 (B:1-194,B:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa)}
mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
ctgvwagvlqpdplXqvrlereqlrfgssntevihnyghggygltihwgcalevaklfgk
vleernl

Timeline for d1kifb1:

• d1kifb1 first appeared (with stable ids) in SCOP 1.55
  
• d1kifb1 appears in SCOP 1.69
  
• d1kifb1 appears in SCOP 1.73
  
• d1kifb1 appears in the current release, SCOPe 2.08