Lineage for d3p3mc3 (3p3m C:321-415)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2793864Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793865Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2793974Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 2793975Protein automated matches [254425] (18 species)
    not a true protein
  7. 2794039Species Sulfolobus solfataricus [TaxId:2287] [255783] (6 PDB entries)
  8. 2794047Domain d3p3mc3: 3p3m C:321-415 [306214]
    Other proteins in same PDB: d3p3ma1, d3p3ma2, d3p3mb1, d3p3mb2, d3p3mc1, d3p3mc2, d3p3md1, d3p3md2, d3p3me1, d3p3me2, d3p3mf1, d3p3mf2
    automated match to d4m53a3
    complexed with gtp

Details for d3p3mc3

PDB Entry: 3p3m (more details), 2.8 Å

PDB Description: Gamma-subunit of the translation initiation factor 2 from S. solfataricus complexed with GTP
PDB Compounds: (C:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d3p3mc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p3mc3 b.44.1.0 (C:321-415) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei

SCOPe Domain Coordinates for d3p3mc3:

Click to download the PDB-style file with coordinates for d3p3mc3.
(The format of our PDB-style files is described here.)

Timeline for d3p3mc3: