| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein automated matches [190047] (29 species) not a true protein |
| Species Sulfolobus solfataricus [TaxId:2287] [255781] (5 PDB entries) |
| Domain d3p3mc1: 3p3m C:2-206 [306212] Other proteins in same PDB: d3p3ma2, d3p3ma3, d3p3mb2, d3p3mb3, d3p3mc2, d3p3mc3, d3p3md2, d3p3md3, d3p3me2, d3p3me3, d3p3mf2, d3p3mf3 automated match to d2qn6a3 complexed with gtp |
PDB Entry: 3p3m (more details), 2.8 Å
SCOPe Domain Sequences for d3p3mc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p3mc1 c.37.1.8 (C:2-206) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
pvsalhkinidsliegieeyiktpy
Timeline for d3p3mc1: