SCOPe 2.06: Domain d3p0ef_: 3p0e F:

Lineage for d3p0ef_ (3p0e F:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (41 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [267813] (6 PDB entries)

8. Domain d3p0ef_: 3p0e F: [306202]
   automated match to d2xrfa_
   complexed with bau, po4

Details for d3p0ef_

PDB Entry: 3p0e, 2 Å

PDB Description: structure of hupp2 in an active conformation with bound 5- benzylacyclouridine

PDB Compounds: (F:) uridine phosphorylase 2

SCOPe Domain Sequences for d3p0ef_:

Sequence, based on SEQRES records:

>d3p0ef_ c.56.2.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalfmhkelg
feeaeedikdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharccdvtii
rigtsggigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelfncskei
pnfptlvghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemestvfaam
cglcglkaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlg

Sequence, based on observed residues (ATOM records):

>d3p0ef_ c.56.2.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalfmhkelg
fikdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharccdvtiirigtsg
gigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelfncskeipnfptl
vghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemestvfaamcglcgl
kaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlg

Timeline for d3p0ef_:

• d3p0ef_ is new in SCOPe 2.06-stable
  
• d3p0ef_ appears in SCOPe 2.07
  
• d3p0ef_ appears in the current release, SCOPe 2.08