Lineage for d3p0ea_ (3p0e A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2888846Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2888847Protein automated matches [190781] (46 species)
    not a true protein
  7. 2889142Species Human (Homo sapiens) [TaxId:9606] [267813] (6 PDB entries)
  8. 2889152Domain d3p0ea_: 3p0e A: [306197]
    automated match to d2xrfa_
    complexed with bau, po4

Details for d3p0ea_

PDB Entry: 3p0e (more details), 2 Å

PDB Description: structure of hupp2 in an active conformation with bound 5- benzylacyclouridine
PDB Compounds: (A:) uridine phosphorylase 2

SCOPe Domain Sequences for d3p0ea_:

Sequence, based on SEQRES records: (download)

>d3p0ea_ c.56.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalfmhkelg
feeaeedikdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharccdvtii
rigtsggigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelfncskei
pnfptlvghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemestvfaam
cglcglkaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlg

Sequence, based on observed residues (ATOM records): (download)

>d3p0ea_ c.56.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalfmhkelg
fikdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharccdvtiirigtsg
gigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelfncskeipnfptl
vghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemestvfaamcglcgl
kaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlg

SCOPe Domain Coordinates for d3p0ea_:

Click to download the PDB-style file with coordinates for d3p0ea_.
(The format of our PDB-style files is described here.)

Timeline for d3p0ea_: