Lineage for d3p0dk_ (3p0d K:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767216Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2767240Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
    Pfam PF00963
  6. 2767311Protein Scaffolding dockerin binding protein A, SdbA [141078] (1 species)
  7. 2767312Species Clostridium thermocellum [TaxId:1515] [141079] (4 PDB entries)
    Uniprot P71143 30-191! Uniprot P71143 30-195
  8. 2767322Domain d3p0dk_: 3p0d K: [306196]
    Other proteins in same PDB: d3p0da1, d3p0da2, d3p0dd1, d3p0dd2, d3p0dg1, d3p0dg2, d3p0dj1, d3p0dj2
    automated match to d2b59a1
    complexed with ca, so4

Details for d3p0dk_

PDB Entry: 3p0d (more details), 2.9 Å

PDB Description: Crystal structure of a multimodular ternary protein complex from Clostridium thermocellum
PDB Compounds: (K:) scaffolding dockerin binding protein a

SCOPe Domain Sequences for d3p0dk_:

Sequence, based on SEQRES records: (download)

>d3p0dk_ b.2.2.2 (K:) Scaffolding dockerin binding protein A, SdbA {Clostridium thermocellum [TaxId: 1515]}
assielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkeftsst
fppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaeesgiiakigfkil
qkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvlsl

Sequence, based on observed residues (ATOM records): (download)

>d3p0dk_ b.2.2.2 (K:) Scaffolding dockerin binding protein A, SdbA {Clostridium thermocellum [TaxId: 1515]}
assielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdptgkeftsstf
ppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaeesgiiakigfkilq
kkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvlsl

SCOPe Domain Coordinates for d3p0dk_:

Click to download the PDB-style file with coordinates for d3p0dk_.
(The format of our PDB-style files is described here.)

Timeline for d3p0dk_: