Lineage for d3ouob_ (3ouo B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739394Fold a.299: Tenuivirus/Phlebovirus nucleocapsid protein-like [310560] (1 superfamily)
  4. 2739395Superfamily a.299.1: Tenuivirus/Phlebovirus nucleocapsid protein [310587] (1 family) (S)
    Pfam PF05733
  5. 2739396Family a.299.1.1: Phlebovirus nucleocapsid protein [310634] (3 proteins)
  6. 2739397Protein Rift Valley fever virus (RVFV) N protein [310764] (1 species)
  7. 2739398Species Rift Valley fever virus [TaxId:11588] [311019] (6 PDB entries)
  8. 2739411Domain d3ouob_: 3ouo B: [306180]
    automated match to d3lyfa_
    complexed with no2

Details for d3ouob_

PDB Entry: 3ouo (more details), 2.3 Å

PDB Description: Structure of the Nucleoprotein from Rift Valley Fever Virus
PDB Compounds: (B:) nucleoprotein

SCOPe Domain Sequences for d3ouob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ouob_ a.299.1.1 (B:) Rift Valley fever virus (RVFV) N protein {Rift Valley fever virus [TaxId: 11588]}
dnyqelrvqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivla
ltrgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagwtcqalvv
lsewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvin
pnlrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqay
ktaa

SCOPe Domain Coordinates for d3ouob_:

Click to download the PDB-style file with coordinates for d3ouob_.
(The format of our PDB-style files is described here.)

Timeline for d3ouob_: