SCOPe 2.08: Domain d3ouob_: 3ouo B:

Lineage for d3ouob_ (3ouo B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.299: Tenuivirus/Phlebovirus nucleocapsid protein-like [310560] (1 superfamily)

4. Superfamily a.299.1: Tenuivirus/Phlebovirus nucleocapsid protein [310587] (1 family)
   Pfam PF05733

5. Family a.299.1.1: Phlebovirus nucleocapsid protein [310634] (3 proteins)

6. Protein Rift Valley fever virus (RVFV) N protein [310764] (1 species)

7. Species Rift Valley fever virus [TaxId:11588] [311019] (6 PDB entries)

8. Domain d3ouob_: 3ouo B: [306180]
   automated match to d3lyfa_
   complexed with no2

Details for d3ouob_

PDB Entry: 3ouo, 2.3 Å

PDB Description: Structure of the Nucleoprotein from Rift Valley Fever Virus

PDB Compounds: (B:) nucleoprotein

SCOPe Domain Sequences for d3ouob_:

Sequence; same for both SEQRES and ATOM records:

>d3ouob_ a.299.1.1 (B:) Rift Valley fever virus (RVFV) N protein {Rift Valley fever virus [TaxId: 11588]}
dnyqelrvqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivla
ltrgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagwtcqalvv
lsewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvin
pnlrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqay
ktaa

Timeline for d3ouob_:

• d3ouob_ first appeared in SCOPe 2.06
  
• d3ouob_ appears in SCOPe 2.07