SCOPe 2.06: Domain d1an9b1: 1an9 B:1-194,B:288-340

Lineage for d1an9b1 (1an9 B:1-194,B:288-340)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families)
   this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains

5. Family c.4.1.2: D-aminoacid oxidase, N-terminal domain [51979] (1 protein)
   This family is probably related to the FAD-linked reductases and shares with them the C-terminal domain fold

6. Protein D-aminoacid oxidase, N-terminal domain [51980] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51981] (7 PDB entries)

8. Domain d1an9b1: 1an9 B:1-194,B:288-340 [30618]
   Other proteins in same PDB: d1an9a2, d1an9b2
   complexed with be2, fad

Details for d1an9b1

PDB Entry: 1an9, 2.5 Å

PDB Description: d-amino acid oxidase complex with o-aminobenzoate

PDB Compounds: (B:) d-amino acid oxidase

SCOPe Domain Sequences for d1an9b1:

Sequence; same for both SEQRES and ATOM records:

>d1an9b1 c.4.1.2 (B:1-194,B:288-340) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
ctgvwagvlqpdplXqvrlereqlrfgssntevihnyghggygltihwgcalevaklfgk
vleernll

Timeline for d1an9b1:

• d1an9b1 first appeared (with stable ids) in SCOP 1.55
  
• d1an9b1 appears in SCOPe 2.05
  
• d1an9b1 appears in SCOPe 2.07
  
• d1an9b1 appears in the current release, SCOPe 2.08