Lineage for d3otib1 (3oti B:2-375)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142524Family c.87.1.13: UrdGT2-like [310622] (2 protein domains)
    Pfam PF06722
  6. 2142525Protein Calicheamicin glycosyltransferase CalG3 [310723] (1 species)
  7. 2142526Species Micromonospora echinospora [TaxId:1877] [310970] (3 PDB entries)
  8. 2142528Domain d3otib1: 3oti B:2-375 [306177]
    Other proteins in same PDB: d3otia2, d3otib2
    automated match to d3d0ra_
    complexed with c0t, cl, tyd

Details for d3otib1

PDB Entry: 3oti (more details), 1.6 Å

PDB Description: crystal structure of calg3, calicheamicin glycostyltransferase, tdp and calicheamicin t0 bound form
PDB Compounds: (B:) CalG3

SCOPe Domain Sequences for d3otib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3otib1 c.87.1.13 (B:2-375) Calicheamicin glycosyltransferase CalG3 {Micromonospora echinospora [TaxId: 1877]}
lfvsspgighlfpliqlawgfrtaghdvliavaehadraaaaglevvdvapdysavkvfe
qvakdnprfaetvatrpaidleewgvqiaavnrplvdgtmalvddyrpdlvvyeqgatvg
llaadragvpavqrnqsawrtrgmhrsiasfltdlmdkhqvslpepvatiesfppsllle
aepegwfmrwvpygggavlgdrlppvparpevaitmgtielqafgigavepiiaaagevd
adfvlalgdldisplgtlprnvravgwtplhtllrtctavvhhggggtvmtaidagipql
lapdprdqfqhtareavsrrgiglvstsdkvdadllrrligdeslrtaarevreemvalp
tpaetvrriveris

SCOPe Domain Coordinates for d3otib1:

Click to download the PDB-style file with coordinates for d3otib1.
(The format of our PDB-style files is described here.)

Timeline for d3otib1:

  • d3otib1 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d3otib2