![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily) consists of two non-similar domains with 3 layers (a/b/a) each domain 1: parallel beta-sheet of 7 strands, order 3214567 domain 2: parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) ![]() |
![]() | Family c.87.1.0: automated matches [191559] (1 protein) not a true family |
![]() | Protein automated matches [190965] (40 species) not a true protein |
![]() | Species Micromonospora echinospora [TaxId:1877] [311324] (2 PDB entries) |
![]() | Domain d3otga1: 3otg A:1-388 [306170] Other proteins in same PDB: d3otga2 automated match to d2p6pa_ complexed with cl, tyd |
PDB Entry: 3otg (more details), 2.08 Å
SCOPe Domain Sequences for d3otga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3otga1 c.87.1.0 (A:1-388) automated matches {Micromonospora echinospora [TaxId: 1877]} mrvlfaslgthghtypllplataaraaghevtfatgegfagtlrklgfepvatgmpvfdg flaalrirfdtdspegltpeqlselpqivfgrvipqrvfdelqpvierlrpdlvvqeisn ygaglaalkagiptichgvgrdtpddltrsieeevrglaqrlgldlppgridgfgnpfid ifppslqepefrarprrhelrpvpfaeqgdlpawlssrdtarplvyltlgtssggtvevl raaidglagldadvlvasgpsldvsglgevpanvrleswvpqaallphvdlvvhhggsgt tlgalgagvpqlsfpwagdsfanaqavaqagagdhllpdnispdsvsgaakrllaeesyr agaravaaeiaampgpdevvrllpgfas
Timeline for d3otga1: