Lineage for d3ooxb_ (3oox B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2071232Family b.82.2.0: automated matches [191672] (1 protein)
    not a true family
  6. 2071233Protein automated matches [191281] (13 species)
    not a true protein
  7. 2071234Species Caulobacter crescentus [TaxId:190650] [311323] (1 PDB entry)
  8. 2071236Domain d3ooxb_: 3oox B: [306118]
    automated match to d5c3qa_
    complexed with cl, edo

Details for d3ooxb_

PDB Entry: 3oox (more details), 1.44 Å

PDB Description: crystal structure of a putative 2og-fe(ii) oxygenase family protein (cc_0200) from caulobacter crescentus at 1.44 a resolution
PDB Compounds: (B:) putative 2OG-Fe(II) oxygenase family protein

SCOPe Domain Sequences for d3ooxb_:

Sequence, based on SEQRES records: (download)

>d3ooxb_ b.82.2.0 (B:) automated matches {Caulobacter crescentus [TaxId: 190650]}
tsaidpvsfslyakdftrfaqelgasferygfavlsdydldqaridaavdsakaffalpv
etkkqyagvkggargyipfgvetakgadhydlkefwhmgrdlppghrfrahmadnvwpae
ipafkhdvswlynsldgmggkvleaiatylklerdffkptvqdgnsvlrllhyppipkda
tgvragahgdintitlllgaeegglevldrdgqwlpinpppgclvinigdmlerltnnvl
pstvhrvvnppperrgvprystpfflhfasdyeiktlqncvtaenpdrypesitadeflq
qrlrei

Sequence, based on observed residues (ATOM records): (download)

>d3ooxb_ b.82.2.0 (B:) automated matches {Caulobacter crescentus [TaxId: 190650]}
tsaidpvsfslyakdftrfaqelgasferygfavlsdydldqaridaavdsakaffalpv
etkkqyagvkggargyipfgvetakgadhydlkefwhmgrdlppghrfrahmadnvwpae
ipafkhdvswlynsldgmggkvleaiatylklerdffkptvqdgnsvlrllhyppipkda
tvragahgdintitlllgaeegglevldrdgqwlpinpppgclvinigdmlerltnnvlp
stvhrvvnppperrgvprystpfflhfasdyeiktlqncvtaenpdrypesitadeflqq
rlrei

SCOPe Domain Coordinates for d3ooxb_:

Click to download the PDB-style file with coordinates for d3ooxb_.
(The format of our PDB-style files is described here.)

Timeline for d3ooxb_:

  • d3ooxb_ is new in SCOPe 2.06-stable