Lineage for d3oega_ (3oeg A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2068796Fold b.75: Bacteriochlorophyll A protein [51080] (1 superfamily)
    single sheet; 16 strands; meander
  4. 2068797Superfamily b.75.1: Bacteriochlorophyll A protein [51081] (1 family) (S)
    automatically mapped to Pfam PF02327
  5. 2068798Family b.75.1.1: Bacteriochlorophyll A protein [51082] (2 protein domains)
  6. 2068808Protein automated matches [190386] (3 species)
    not a true protein
  7. 2068813Species Pelodictyon phaeum [TaxId:34091] [189887] (2 PDB entries)
  8. 2068815Domain d3oega_: 3oeg A: [306114]
    automated match to d3eoja_
    complexed with bcl

Details for d3oega_

PDB Entry: 3oeg (more details), 1.99 Å

PDB Description: Structure of the FMO protein from Pelodictyon phaeum
PDB Compounds: (A:) Bacteriochlorophyll a protein

SCOPe Domain Sequences for d3oega_:

Sequence, based on SEQRES records: (download)

>d3oega_ b.75.1.1 (A:) automated matches {Pelodictyon phaeum [TaxId: 34091]}
tttahsdyeiileggssswgqikgrakvnvpaalpllpadcnikieakpldaqkgvvrft
sqiesivdstknklvvevdianetkdrriavgegevsvgdfshkfsfegsvvnmyyyrsd
avrrnvpnpvymqgrqfhdimmkvpldnkdlietwegfqqsisgggvnfgdwirefwfig
paytaineggqrispiqvnnfgvesgekgpvgvsrwkfshagsgivdsisrwaelfpveq
lnkpasieggfrsdsqgievkvdgnlpgvsrdaggglrrilnhpliplvhhgmvgkfndf
tvdtqlkvvlpkgykiryaapqfrsqnleeyrwsggayarwvehvckggtgqfevlyaq

Sequence, based on observed residues (ATOM records): (download)

>d3oega_ b.75.1.1 (A:) automated matches {Pelodictyon phaeum [TaxId: 34091]}
tttahsdyeiileggssswgqikgrakvnvpaalpllpadcnikieakpldaqkgvvrft
sqiesivdstknklvvevdianetkdrriavgegevsvgdfshkfsfegsvvnmyyyrsd
avrrnvpnpvymqgrqfhdimmkvpldnkdlietwegfqqsisgggvnfgdwirefwfig
paytaineggqrispiqvnnfgveskgpvgvsrwkfshagsgivdsisrwaelfpveqln
kpasieggfrsdsqgievkvdgnlpgvsrdaggglrrilnhpliplvhhgmvgkfndftv
dtqlkvvlpkgykiryaapqfrsqnleeyrwsggayarwvehvckggtgqfevlyaq

SCOPe Domain Coordinates for d3oega_:

Click to download the PDB-style file with coordinates for d3oega_.
(The format of our PDB-style files is described here.)

Timeline for d3oega_:

  • d3oega_ is new in SCOPe 2.06-stable