SCOPe 2.06: Domain d3obca1: 3obc A:1-100

Lineage for d3obca1 (3obc A:1-100)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.0: automated matches [191410] (1 protein)
   not a true family

6. Protein automated matches [190562] (4 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [189451] (2 PDB entries)

8. Domain d3obca1: 3obc A:1-100 [306108]
   Other proteins in same PDB: d3obca2, d3obcb2
   automated match to d4qgpa_
   complexed with cl, peg, pge, zn

Details for d3obca1

PDB Entry: 3obc, 1.8 Å

PDB Description: Crystal structure of a pyrophosphatase (AF1178) from Archaeoglobus fulgidus at 1.80 A resolution

PDB Compounds: (A:) pyrophosphatase

SCOPe Domain Sequences for d3obca1:

Sequence; same for both SEQRES and ATOM records:

>d3obca1 a.204.1.0 (A:1-100) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
meelldilrefrdsrgwlkyhtpknlavsisievaelleifqwtrssdeefevlerrkge
veeeiadvliyllflcdvaeinpieavkrkmeknerkypk

Timeline for d3obca1:

• d3obca1 is new in SCOPe 2.06-stable
  
• d3obca1 appears in SCOPe 2.07
  
• d3obca1 appears in the current release, SCOPe 2.08