Lineage for d3obca1 (3obc A:1-100)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736411Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. 2736412Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. 2736503Family a.204.1.0: automated matches [191410] (1 protein)
    not a true family
  6. 2736504Protein automated matches [190562] (4 species)
    not a true protein
  7. 2736505Species Archaeoglobus fulgidus [TaxId:2234] [189451] (2 PDB entries)
  8. 2736506Domain d3obca1: 3obc A:1-100 [306108]
    Other proteins in same PDB: d3obca2, d3obcb2
    automated match to d4qgpa_
    complexed with cl, peg, pge, zn

Details for d3obca1

PDB Entry: 3obc (more details), 1.8 Å

PDB Description: Crystal structure of a pyrophosphatase (AF1178) from Archaeoglobus fulgidus at 1.80 A resolution
PDB Compounds: (A:) pyrophosphatase

SCOPe Domain Sequences for d3obca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3obca1 a.204.1.0 (A:1-100) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
meelldilrefrdsrgwlkyhtpknlavsisievaelleifqwtrssdeefevlerrkge
veeeiadvliyllflcdvaeinpieavkrkmeknerkypk

SCOPe Domain Coordinates for d3obca1:

Click to download the PDB-style file with coordinates for d3obca1.
(The format of our PDB-style files is described here.)

Timeline for d3obca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3obca2