![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
![]() | Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) ![]() basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
![]() | Family a.204.1.0: automated matches [191410] (1 protein) not a true family |
![]() | Protein automated matches [190562] (4 species) not a true protein |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [189451] (2 PDB entries) |
![]() | Domain d3obca1: 3obc A:1-100 [306108] Other proteins in same PDB: d3obca2, d3obcb2 automated match to d4qgpa_ complexed with cl, peg, pge, zn |
PDB Entry: 3obc (more details), 1.8 Å
SCOPe Domain Sequences for d3obca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3obca1 a.204.1.0 (A:1-100) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} meelldilrefrdsrgwlkyhtpknlavsisievaelleifqwtrssdeefevlerrkge veeeiadvliyllflcdvaeinpieavkrkmeknerkypk
Timeline for d3obca1: