SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3o7zc2 (3o7z C:227-622)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2081497Family c.1.8.1: Amylase, catalytic domain [51446] (26 protein domains)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2081989Protein automated matches [190099] (24 species)
    not a true protein
  7. 2082032Species Escherichia coli [TaxId:562] [270950] (4 PDB entries)
  8. 2082039Domain d3o7zc2: 3o7z C:227-622 [306095]
    Other proteins in same PDB: d3o7za1, d3o7za3, d3o7zb1, d3o7zb3, d3o7zc1, d3o7zc3, d3o7zd1, d3o7zd3
    automated match to d1m7xa3
    complexed with glc, gol

Details for d3o7zc2

PDB Entry: 3o7z (more details), 2.55 Å

PDB Description: Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose
PDB Compounds: (C:) 1,4-alpha-glucan-branching enzyme

SCOPe Domain Sequences for d3o7zc2:

Sequence, based on SEQRES records: (download)

>d3o7zc2 c.1.8.1 (C:227-622) automated matches {Escherichia coli [TaxId: 562]}
vvqteerkkanqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlel
lpinehpfdgswgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddf
alaefdgtnlyehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvda
vasmiyrdysrkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgv
srpqdmgglgfwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshd
evvhgkksildrmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldw
hlleggdnwhhgvqrlvrdlnltyrhhkamheldfd

Sequence, based on observed residues (ATOM records): (download)

>d3o7zc2 c.1.8.1 (C:227-622) automated matches {Escherichia coli [TaxId: 562]}
vvqteerkkanqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlel
lpinehpfdgswgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddf
alaefdgtnlyehsliynygrrevsnflvgnalywierfgidalrvdavasmiyrdnefg
grenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhd
tldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfa
nlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnl
tyrhhkamheldfd

SCOPe Domain Coordinates for d3o7zc2:

Click to download the PDB-style file with coordinates for d3o7zc2.
(The format of our PDB-style files is described here.)

Timeline for d3o7zc2:

  • d3o7zc2 is new in SCOPe 2.06-stable