Lineage for d3o7zc1 (3o7z C:118-226)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766271Species Escherichia coli [TaxId:562] [270946] (4 PDB entries)
  8. 2766278Domain d3o7zc1: 3o7z C:118-226 [306094]
    Other proteins in same PDB: d3o7za2, d3o7za3, d3o7zb2, d3o7zb3, d3o7zc2, d3o7zc3, d3o7zd2, d3o7zd3
    automated match to d1m7xa1
    complexed with glc, gol

Details for d3o7zc1

PDB Entry: 3o7z (more details), 2.55 Å

PDB Description: Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose
PDB Compounds: (C:) 1,4-alpha-glucan-branching enzyme

SCOPe Domain Sequences for d3o7zc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o7zc1 b.1.18.0 (C:118-226) automated matches {Escherichia coli [TaxId: 562]}
hlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwel
fipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpek

SCOPe Domain Coordinates for d3o7zc1:

Click to download the PDB-style file with coordinates for d3o7zc1.
(The format of our PDB-style files is described here.)

Timeline for d3o7zc1: