| Class b: All beta proteins [48724] (177 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
| Protein automated matches [226835] (34 species) not a true protein |
| Species Escherichia coli [TaxId:562] [270953] (4 PDB entries) |
| Domain d3o7zb3: 3o7z B:623-728 [306093] Other proteins in same PDB: d3o7za1, d3o7za2, d3o7zb1, d3o7zb2, d3o7zc1, d3o7zc2, d3o7zd1, d3o7zd2 automated match to d1m7xa2 complexed with glc, gol |
PDB Entry: 3o7z (more details), 2.55 Å
SCOPe Domain Sequences for d3o7zb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o7zb3 b.71.1.0 (B:623-728) automated matches {Escherichia coli [TaxId: 562]}
pygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreilntd
smhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae
Timeline for d3o7zb3: