Lineage for d3o7yd3 (3o7y D:623-728)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810971Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2810972Protein automated matches [226835] (41 species)
    not a true protein
  7. 2811044Species Escherichia coli [TaxId:562] [270953] (4 PDB entries)
  8. 2811048Domain d3o7yd3: 3o7y D:623-728 [306087]
    Other proteins in same PDB: d3o7ya1, d3o7ya2, d3o7yb1, d3o7yb2, d3o7yc1, d3o7yc2, d3o7yd1, d3o7yd2
    automated match to d1m7xa2
    complexed with gol

Details for d3o7yd3

PDB Entry: 3o7y (more details), 2.41 Å

PDB Description: Crystal Structure of E.Coli Branching Enzyme in complex with linear oligosaccharides
PDB Compounds: (D:) 1,4-alpha-glucan-branching enzyme

SCOPe Domain Sequences for d3o7yd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o7yd3 b.71.1.0 (D:623-728) automated matches {Escherichia coli [TaxId: 562]}
pygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreilntd
smhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae

SCOPe Domain Coordinates for d3o7yd3:

Click to download the PDB-style file with coordinates for d3o7yd3.
(The format of our PDB-style files is described here.)

Timeline for d3o7yd3: