SCOPe 2.07: Domain d3o7yc1: 3o7y C:118-226

Lineage for d3o7yc1 (3o7y C:118-226)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (72 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [270946] (4 PDB entries)

8. Domain d3o7yc1: 3o7y C:118-226 [306082]
   Other proteins in same PDB: d3o7ya2, d3o7ya3, d3o7yb2, d3o7yb3, d3o7yc2, d3o7yc3, d3o7yd2, d3o7yd3
   automated match to d1m7xa1
   complexed with gol

Details for d3o7yc1

PDB Entry: 3o7y, 2.41 Å

PDB Description: Crystal Structure of E.Coli Branching Enzyme in complex with linear oligosaccharides

PDB Compounds: (C:) 1,4-alpha-glucan-branching enzyme

SCOPe Domain Sequences for d3o7yc1:

Sequence, based on SEQRES records:

>d3o7yc1 b.1.18.0 (C:118-226) automated matches {Escherichia coli [TaxId: 562]}
hlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwel
fipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpek

Sequence, based on observed residues (ATOM records):

>d3o7yc1 b.1.18.0 (C:118-226) automated matches {Escherichia coli [TaxId: 562]}
hlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwel
fipgahngqlykyemidangnlrlksdpyafeaqrpetaslicglpek

Timeline for d3o7yc1:

• d3o7yc1 first appeared in SCOPe 2.06
  
• d3o7yc1 appears in the current release, SCOPe 2.08