![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [270946] (4 PDB entries) |
![]() | Domain d3o7yc1: 3o7y C:118-226 [306082] Other proteins in same PDB: d3o7ya2, d3o7ya3, d3o7yb2, d3o7yb3, d3o7yc2, d3o7yc3, d3o7yd2, d3o7yd3 automated match to d1m7xa1 complexed with gol |
PDB Entry: 3o7y (more details), 2.41 Å
SCOPe Domain Sequences for d3o7yc1:
Sequence, based on SEQRES records: (download)
>d3o7yc1 b.1.18.0 (C:118-226) automated matches {Escherichia coli [TaxId: 562]} hlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwel fipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpek
>d3o7yc1 b.1.18.0 (C:118-226) automated matches {Escherichia coli [TaxId: 562]} hlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwel fipgahngqlykyemidangnlrlksdpyafeaqrpetaslicglpek
Timeline for d3o7yc1: