SCOP 1.65: Domain d1e1na2: 1e1n A:6-106,A:332-460

Lineage for d1e1na2 (1e1n A:6-106,A:332-460)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families)
   this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains

5. Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (4 proteins)

6. Protein Adrenodoxin reductase of mitochondrial p450 systems [51975] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [51976] (6 PDB entries)

8. Domain d1e1na2: 1e1n A:6-106,A:332-460 [30608]
   Other proteins in same PDB: d1e1na1
   complexed with fad

Details for d1e1na2

PDB Entry: 1e1n, 2.4 Å

PDB Description: structure of adrenodoxin reductase at 2.4 angstrom in crystal form a'

SCOP Domain Sequences for d1e1na2:

Sequence; same for both SEQRES and ATOM records:

>d1e1na2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus)}
tpqicvvgsgpagfytaqhllkhhsrahvdiyekqlvpfglvrfgvapdhpevknvintf
tqtarsdrcafygnvevgrdvtvqelqdayhavvlsygaedXksrpidpsvpfdpklgvv
pnmegrvvdvpglycsgwvkrgptgvitttmtdsfltgqillqdlkaghlpsgprpgsaf
ikalldsrgvwpvsfsdwekldaeevsrgqasgkpreklldpqemlrllgh

Timeline for d1e1na2:

• d1e1na2 first appeared (with stable ids) in SCOP 1.55
  
• d1e1na2 appears in SCOP 1.63
  
• d1e1na2 appears in SCOP 1.67
  
• d1e1na2 appears in the current release, SCOPe 2.08