Lineage for d3o2ga1 (3o2g A:1-95)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3012203Fold d.392: GBBH N-terminal domain-like [310570] (1 superfamily)
    beta(3)-alpha-beta(3)-alpha; 2 layers; two antiparallel beta sheets, order 123; often Zn-binding
  4. 3012204Superfamily d.392.1: GBBH N-terminal domain-like (DUF971) [310602] (2 families) (S)
    Pfam PF06155
  5. 3012205Family d.392.1.1: GBBH N-terminal domain-like (DUF971) [310652] (3 proteins)
  6. 3012209Protein Gamma-butyrobetaine dioxygenase (BBOX1) N-terminal domain [310811] (1 species)
  7. 3012210Species Human (Homo sapiens) [TaxId:9606] [311077] (4 PDB entries)
  8. 3012211Domain d3o2ga1: 3o2g A:1-95 [306073]
    Other proteins in same PDB: d3o2ga2, d3o2ga3
    automated match to d3ms5a1
    complexed with edo, nm2, oga, zn

Details for d3o2ga1

PDB Entry: 3o2g (more details), 1.78 Å

PDB Description: crystal structure of human gamma-butyrobetaine,2-oxoglutarate dioxygenase 1 (bbox1)
PDB Compounds: (A:) Gamma-butyrobetaine dioxygenase

SCOPe Domain Sequences for d3o2ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o2ga1 d.392.1.1 (A:1-95) Gamma-butyrobetaine dioxygenase (BBOX1) N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mactiqkaealdgahlmqilwydeeeslypavwlrdncpcsdcyldsakarkllvealdv
nigikglifdrkkvyitwpdehysefqadwlkkrc

SCOPe Domain Coordinates for d3o2ga1:

Click to download the PDB-style file with coordinates for d3o2ga1.
(The format of our PDB-style files is described here.)

Timeline for d3o2ga1: