Lineage for d3nzma_ (3nzm A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2407441Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily)
    complex fold made of five beta-hairpin units and a b-ribbon arc
  4. 2407442Superfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (3 families) (S)
    duplication: contains two intertwined structural repeats
  5. 2407476Family b.86.1.0: automated matches [254252] (1 protein)
    not a true family
  6. 2407477Protein automated matches [254576] (3 species)
    not a true protein
  7. 2407488Species Synechocystis sp. [TaxId:1148] [267771] (3 PDB entries)
  8. 2407489Domain d3nzma_: 3nzm A: [306070]
    automated match to d1zdea_
    complexed with so4

Details for d3nzma_

PDB Entry: 3nzm (more details), 1.55 Å

PDB Description: Crystal structure of DNAE intein with N-extein in redox trap
PDB Compounds: (A:) DNA polymerase III subunit alpha

SCOPe Domain Sequences for d3nzma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nzma_ b.86.1.0 (A:) automated matches {Synechocystis sp. [TaxId: 1148]}
pfcpgclsfgteiltveygplpigkivseeincsvysvdpegrvytqaiaqwhdrgeqev
leyeledgsviratsdhrflttdyqllaieeifarqldlltlenikqteealdnhrlpfp
lldagtikmvkvigrrslgvqrifdiglpqdhnfllangaiaax

SCOPe Domain Coordinates for d3nzma_:

Click to download the PDB-style file with coordinates for d3nzma_.
(The format of our PDB-style files is described here.)

Timeline for d3nzma_: