SCOPe 2.08: Domain d3nu1b_: 3nu1 B:

Lineage for d3nu1b_ (3nu1 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.0: automated matches [191548] (1 protein)
   not a true family

6. Protein automated matches [190944] (40 species)
   not a true protein

7. Species Yersinia pestis [TaxId:360102] [311322] (1 PDB entry)

8. Domain d3nu1b_: 3nu1 B: [306069]
   automated match to d2rg7a_
   complexed with hem

Details for d3nu1b_

PDB Entry: 3nu1, 2.5 Å

PDB Description: Structure of holo form of a periplasmic heme binding protein

PDB Compounds: (B:) Hemin-binding periplasmic protein

SCOPe Domain Sequences for d3nu1b_:

Sequence; same for both SEQRES and ATOM records:

>d3nu1b_ c.92.2.0 (B:) automated matches {Yersinia pestis [TaxId: 360102]}
aerivtiggdvteiayalgagdeivardstsqqpqaaqklpdvgymrtlnaegilamkpt
mllvselaqpslvltqiassgvnvvtvpgqttpesvamkinavatalhqtekgqkliedy
qqrlaavnktplpvkvlfvmshggltpmaagqntaadamiraaggsnamqgfsryrplsq
egviasapdlllittdgvkalgsseniwklpgmaltpagkhkrllvvddmallgfgletp
qvlaqlrekmeqmq

Timeline for d3nu1b_:

• d3nu1b_ first appeared in SCOPe 2.06
  
• d3nu1b_ appears in SCOPe 2.07