SCOPe 2.07: Domain d1e1ka2: 1e1k A:6-106,A:332-460

Lineage for d1e1ka2 (1e1k A:6-106,A:332-460)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families)
   this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains

5. Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)

6. Protein Adrenodoxin reductase of mitochondrial p450 systems [51975] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [51976] (6 PDB entries)

8. Domain d1e1ka2: 1e1k A:6-106,A:332-460 [30606]
   Other proteins in same PDB: d1e1ka1
   complexed with fad, nap

Details for d1e1ka2

PDB Entry: 1e1k, 1.95 Å

PDB Description: adrenodoxin reductase in complex with nadp+ obtained by a soaking experiment

PDB Compounds: (A:) adrenodoxin reductase

SCOPe Domain Sequences for d1e1ka2:

Sequence; same for both SEQRES and ATOM records:

>d1e1ka2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]}
tpqicvvgsgpagfytaqhllkhhsrahvdiyekqlvpfglvrfgvapdhpevknvintf
tqtarsdrcafygnvevgrdvtvqelqdayhavvlsygaedXksrpidpsvpfdpklgvv
pnmegrvvdvpglycsgwvkrgptgvitttmtdsfltgqillqdlkaghlpsgprpgsaf
ikalldsrgvwpvsfsdwekldaeevsrgqasgkpreklldpqemlrllgh

Timeline for d1e1ka2:

• d1e1ka2 first appeared (with stable ids) in SCOP 1.55
  
• d1e1ka2 appears in SCOPe 2.06
  
• d1e1ka2 appears in the current release, SCOPe 2.08