Lineage for d1e1ka2 (1e1k A:6-106,A:332-460)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2458575Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2458576Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 2458577Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)
  6. 2458581Protein Adrenodoxin reductase of mitochondrial p450 systems [51975] (1 species)
  7. 2458582Species Cow (Bos taurus) [TaxId:9913] [51976] (6 PDB entries)
  8. 2458588Domain d1e1ka2: 1e1k A:6-106,A:332-460 [30606]
    Other proteins in same PDB: d1e1ka1
    complexed with fad, nap

Details for d1e1ka2

PDB Entry: 1e1k (more details), 1.95 Å

PDB Description: adrenodoxin reductase in complex with nadp+ obtained by a soaking experiment
PDB Compounds: (A:) adrenodoxin reductase

SCOPe Domain Sequences for d1e1ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1ka2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]}
tpqicvvgsgpagfytaqhllkhhsrahvdiyekqlvpfglvrfgvapdhpevknvintf
tqtarsdrcafygnvevgrdvtvqelqdayhavvlsygaedXksrpidpsvpfdpklgvv
pnmegrvvdvpglycsgwvkrgptgvitttmtdsfltgqillqdlkaghlpsgprpgsaf
ikalldsrgvwpvsfsdwekldaeevsrgqasgkpreklldpqemlrllgh

SCOPe Domain Coordinates for d1e1ka2:

Click to download the PDB-style file with coordinates for d1e1ka2.
(The format of our PDB-style files is described here.)

Timeline for d1e1ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e1ka1