SCOPe 2.07: Domain d3nl4l2: 3nl4 L:110-213

Lineage for d3nl4l2 (3nl4 L:110-213)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (28 PDB entries)

8. Domain d3nl4l2: 3nl4 L:110-213 [306045]
   automated match to d4hbcl2
   complexed with so4

Details for d3nl4l2

PDB Entry: 3nl4, 1.54 Å

PDB Description: Crystal structure of amyloid prefibrillar oligomer-specific rabbit Fab

PDB Compounds: (L:) Antigen Binding Fragment, Immunoglobulin IgG - Light Chain

SCOPe Domain Sequences for d3nl4l2:

Sequence; same for both SEQRES and ATOM records:

>d3nl4l2 b.1.1.0 (L:110-213) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gdpvaptvlifppsadlvatgtvtivcvankyfpdvtvtwevdgttqttgiensktpqns
adctynlsstltltsteynshkeytckvtqgttsvvqsfnrgdc

Timeline for d3nl4l2:

• d3nl4l2 first appeared in SCOPe 2.06
  
• d3nl4l2 appears in the current release, SCOPe 2.08