SCOPe 2.05: Domain d1cjca2: 1cjc A:6-106,A:332-460

Lineage for d1cjca2 (1cjc A:6-106,A:332-460)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families)
   this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains

5. Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)

6. Protein Adrenodoxin reductase of mitochondrial p450 systems [51975] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [51976] (6 PDB entries)

8. Domain d1cjca2: 1cjc A:6-106,A:332-460 [30604]
   Other proteins in same PDB: d1cjca1
   complexed with fad

Details for d1cjca2

PDB Entry: 1cjc, 1.7 Å

PDB Description: structure of adrenodoxin reductase of mitochondrial p450 systems

PDB Compounds: (A:) protein (adrenodoxin reductase)

SCOPe Domain Sequences for d1cjca2:

Sequence; same for both SEQRES and ATOM records:

>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]}
tpqicvvgsgpagfytaqhllkhhsrahvdiyekqlvpfglvrfgvapdhpevknvintf
tqtarsdrcafygnvevgrdvtvqelqdayhavvlsygaedXksrpidpsvpfdpklgvv
pnmegrvvdvpglycsgwvkrgptgvitttmtdsfltgqillqdlkaghlpsgprpgsaf
ikalldsrgvwpvsfsdwekldaeevsrgqasgkpreklldpqemlrllgh

Timeline for d1cjca2:

• d1cjca2 first appeared (with stable ids) in SCOP 1.55
  
• d1cjca2 appears in SCOPe 2.04
  
• d1cjca2 appears in SCOPe 2.06
  
• d1cjca2 appears in the current release, SCOPe 2.08