Lineage for d3ndzd_ (3ndz D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (131 species)
    not a true protein
  7. 2832521Species Clostridium cellulovorans [TaxId:1493] [311320] (3 PDB entries)
  8. 2832530Domain d3ndzd_: 3ndz D: [306038]
    Other proteins in same PDB: d3ndze_, d3ndzf_, d3ndzg_, d3ndzh_
    automated match to d4im4a_

Details for d3ndzd_

PDB Entry: 3ndz (more details), 2.08 Å

PDB Description: the structure of the catalytic and carbohydrate binding domain of endoglucanase d from clostridium cellulovorans bound to cellotriose
PDB Compounds: (D:) Endoglucanase D

SCOPe Domain Sequences for d3ndzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ndzd_ c.1.8.0 (D:) automated matches {Clostridium cellulovorans [TaxId: 1493]}
staftgvrdvpaqqivnemkvgwnlgntmdaiggetnwgnpmtthaminkikeagfntlr
lpvtwdghmgaapeytidqtwmkrveeianyafdndmyviinlhhenewlkpfyaneaqv
kaqltkvwtqiannfkkygdhlifetmneprpvgaslqwtggsyenrevvnrynltavna
iratggnnatryimvptlaasamsttindlvipnndskvivslhmyspyffamdingtss
wgsdydkssldsefdavynkfvkngravvigemgsinknntaarvthaeyyaksakargl
tpiwwdngysvagkaetfgifnrsnltwdapevmkafikgiggss

SCOPe Domain Coordinates for d3ndzd_:

Click to download the PDB-style file with coordinates for d3ndzd_.
(The format of our PDB-style files is described here.)

Timeline for d3ndzd_: