SCOP 1.55: Domain d2tmdb3: 2tmd B:341-489,B:646-729

Lineage for d2tmdb3 (2tmd B:341-489,B:646-729)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)

4. Superfamily c.4.1: Nucleotide-binding domain [51971] (2 families)

5. Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (3 proteins)

6. Protein Trimethylamine dehydrogenase, middle domain [51973] (1 species)

7. Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51974] (3 PDB entries)

8. Domain d2tmdb3: 2tmd B:341-489,B:646-729 [30603]
   Other proteins in same PDB: d2tmda1, d2tmda2, d2tmdb1, d2tmdb2

Details for d2tmdb3

PDB Entry: 2tmd, 2.4 Å

PDB Description: correlation of x-ray deduced and experimental amino acid sequences of trimethylamine dehydrogenase

SCOP Domain Sequences for d2tmdb3:

Sequence; same for both SEQRES and ATOM records:

>d2tmdb3 c.4.1.1 (B:341-489,B:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1}
dirvcigcnvcisrweiggppmictqnatageeyrrgwhpekfrqtknkdsvlivgagps
gseaarvlmesgytvhltdtaekigghlnqvaalpglgewsyhrdyretqitkllkknke
sqlalgqkpmtaddvlqygadkviiatgaXsectlwnelkaresewaendikgiyligda
eaprliadatftghrvareieeanpqiaipykretiawgtphmpggnfkieykv

Timeline for d2tmdb3:

• d2tmdb3 appears in SCOP 1.57
  
• d2tmdb3 appears in the current release, SCOPe 2.08