| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
| Family c.56.2.0: automated matches [191488] (1 protein) not a true family |
| Protein automated matches [190781] (45 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [267813] (6 PDB entries) |
| Domain d3nbqa_: 3nbq A: [306025] automated match to d2xrfa_ complexed with urf |
PDB Entry: 3nbq (more details), 2.3 Å
SCOPe Domain Sequences for d3nbqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nbqa_ c.56.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dcpvrllnpniakmkedilyhfnlttsrhnfpalfgdvkfvcvggspsrmkafircvgae
lgldcpgrdypnicagtdryamykvgpvlsvshgmgipsisimlhelikllyyarcsnvt
iirigtsggiglepgtvviteqavdtcfkaefeqivlgkrvirktdlnkklvqelllcsa
elsefttvvgntmctldfyegqgrldgalcsytekdkqayleaayaagvrniemessvfa
amcsacglqaavvcvtllnrlegdqissprnvlseyqqrpqrlvsyfikkkls
Timeline for d3nbqa_: