SCOPe 2.06: Domain d3naja2: 3naj A:155-291

Lineage for d3naja2 (3naj A:155-291)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (53 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (78 PDB entries)

8. Domain d3naja2: 3naj A:155-291 [306024]
   automated match to d4hana2
   mutant

Details for d3naja2

PDB Entry: 3naj, 2.8 Å

PDB Description: Crystal structure of a protease-resistant mutant form of human galectin-8

PDB Compounds: (A:) Galectin-8

SCOPe Domain Sequences for d3naja2:

Sequence; same for both SEQRES and ATOM records:

>d3naja2 b.29.1.0 (A:155-291) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shmrlpfaarlntpmgpgrtvvvkgevnanaksfnvdllagkskdialhlnprlnikafv
rnsflqeswgeeernitsfpfspgmyfemiiycdvrefkvavngvhsleykhrfkelssi
dtleingdihllevrsw

Timeline for d3naja2:

• d3naja2 is new in SCOPe 2.06-stable
  
• d3naja2 appears in SCOPe 2.07
  
• d3naja2 appears in the current release, SCOPe 2.08