Lineage for d3n79a2 (3n79 A:95-184)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2198653Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2198733Family d.58.56.0: automated matches [195116] (1 protein)
    not a true family
  6. 2198734Protein automated matches [195117] (12 species)
    not a true protein
  7. 2198820Species Salmonella enterica [TaxId:90371] [225986] (2 PDB entries)
  8. 2198822Domain d3n79a2: 3n79 A:95-184 [306022]
    automated match to d4qiva_
    complexed with cl, na, so4; mutant

Details for d3n79a2

PDB Entry: 3n79 (more details), 1.5 Å

PDB Description: pdut c38s mutant from salmonella enterica typhimurium
PDB Compounds: (A:) PduT

SCOPe Domain Sequences for d3n79a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n79a2 d.58.56.0 (A:95-184) automated matches {Salmonella enterica [TaxId: 90371]}
qavgivetwsvaacisaadravkgsnvtlvrvhmafgiggkcymvvagdvsdvnnavtva
sesagekgllvyrsviprpheamwrqmveg

SCOPe Domain Coordinates for d3n79a2:

Click to download the PDB-style file with coordinates for d3n79a2.
(The format of our PDB-style files is described here.)

Timeline for d3n79a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3n79a1