SCOPe 2.08: Domain d3n79a1: 3n79 A:2-94

Lineage for d3n79a1 (3n79 A:2-94)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.56: CcmK-like [143414] (2 families)
   contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape

5. Family d.58.56.0: automated matches [195116] (1 protein)
   not a true family

6. Protein automated matches [195117] (13 species)
   not a true protein

7. Species Salmonella enterica [TaxId:90371] [225986] (2 PDB entries)

8. Domain d3n79a1: 3n79 A:2-94 [306021]
   automated match to d4qiva_
   complexed with cl, na, so4; mutant

Details for d3n79a1

PDB Entry: 3n79, 1.5 Å

PDB Description: pdut c38s mutant from salmonella enterica typhimurium

PDB Compounds: (A:) PduT

SCOPe Domain Sequences for d3n79a1:

Sequence; same for both SEQRES and ATOM records:

>d3n79a1 d.58.56.0 (A:2-94) automated matches {Salmonella enterica [TaxId: 90371]}
sqaigileltsiakgmelgdamlksanvdllvsktispgkfllmlggdigaiqqaietgt
sqagemlvdslvlanihpsvlpaisglnsvdkr

Timeline for d3n79a1:

• d3n79a1 first appeared in SCOPe 2.06
  
• d3n79a1 appears in SCOPe 2.07