Lineage for d2tmda3 (2tmd A:341-489,A:646-729)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1155041Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 1155042Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 1155043Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)
  6. 1155084Protein Trimethylamine dehydrogenase, middle domain [51973] (1 species)
  7. 1155085Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51974] (5 PDB entries)
  8. 1155092Domain d2tmda3: 2tmd A:341-489,A:646-729 [30602]
    Other proteins in same PDB: d2tmda1, d2tmda2, d2tmdb1, d2tmdb2
    complexed with adp, fmn, sf4

Details for d2tmda3

PDB Entry: 2tmd (more details), 2.4 Å

PDB Description: correlation of x-ray deduced and experimental amino acid sequences of trimethylamine dehydrogenase
PDB Compounds: (A:) trimethylamine dehydrogenase

SCOPe Domain Sequences for d2tmda3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tmda3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
dirvcigcnvcisrweiggppmictqnatageeyrrgwhpekfrqtknkdsvlivgagps
gseaarvlmesgytvhltdtaekigghlnqvaalpglgewsyhrdyretqitkllkknke
sqlalgqkpmtaddvlqygadkviiatgaXsectlwnelkaresewaendikgiyligda
eaprliadatftghrvareieeanpqiaipykretiawgtphmpggnfkieykv

SCOPe Domain Coordinates for d2tmda3:

Click to download the PDB-style file with coordinates for d2tmda3.
(The format of our PDB-style files is described here.)

Timeline for d2tmda3: