Lineage for d3n6wa2 (3n6w A:96-385)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2070888Family b.82.2.5: TauD/TfdA-like [75038] (5 protein domains)
    automatically mapped to Pfam PF02668
  6. 2070900Protein Gamma-butyrobetaine hydroxylase (GBBH) catalytic domain [310812] (1 species)
  7. 2070901Species Human (Homo sapiens) [TaxId:9606] [311078] (1 PDB entry)
  8. 2070902Domain d3n6wa2: 3n6w A:96-385 [306019]
    Other proteins in same PDB: d3n6wa1, d3n6wa3
    complexed with so4, zn

Details for d3n6wa2

PDB Entry: 3n6w (more details), 2 Å

PDB Description: Crystal structure of human gamma-butyrobetaine hydroxylase
PDB Compounds: (A:) Gamma-butyrobetaine dioxygenase

SCOPe Domain Sequences for d3n6wa2:

Sequence, based on SEQRES records: (download)

>d3n6wa2 b.82.2.5 (A:96-385) Gamma-butyrobetaine hydroxylase (GBBH) catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
fskqaraklqrelffpecqywgselqlptldfedvlrydehaykwlstlkkvgivrltga
sdkpgevsklgkrmgflyltfyghtwqvqdkidannvayttgklsfhtdypalhhppgvq
llhcikqtvtggdseivdgfnvcqklkknnpqafqilsstfvdftdigvdycdfsvqskh
kiielddkgqvvrinfnnatrdtifdvpvervqpfyaalkefvdlmnskeskftfkmnpg
dvitfdnwrllhgrrsyeagteisrhlegayadwdvvmsrlrilrqrven

Sequence, based on observed residues (ATOM records): (download)

>d3n6wa2 b.82.2.5 (A:96-385) Gamma-butyrobetaine hydroxylase (GBBH) catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
fskqaraklqrelffpecqywgselqlptldfedvlrydehaykwlstlkkvgivrltga
sdkpgevsklgkrmgflyltfyghtwqvqdklsfhtdypalhhppgvqllhcikqdseiv
dgfnvcqklkknnpqafqilsstfvdftdigvdycdfsvqskhkiielddkgqvvrinfn
natrdtifdvpvervqpfyaalkefvdlmnskeskftfkmnpgdvitfdnwrllhgrrrh
legayadwdvvmsrlrilrqrven

SCOPe Domain Coordinates for d3n6wa2:

Click to download the PDB-style file with coordinates for d3n6wa2.
(The format of our PDB-style files is described here.)

Timeline for d3n6wa2:

  • d3n6wa2 is new in SCOPe 2.06-stable