Lineage for d3n6wa1 (3n6w A:1-95)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3012203Fold d.392: GBBH N-terminal domain-like [310570] (1 superfamily)
    beta(3)-alpha-beta(3)-alpha; 2 layers; two antiparallel beta sheets, order 123; often Zn-binding
  4. 3012204Superfamily d.392.1: GBBH N-terminal domain-like (DUF971) [310602] (2 families) (S)
    Pfam PF06155
  5. 3012205Family d.392.1.1: GBBH N-terminal domain-like (DUF971) [310652] (3 proteins)
  6. 3012220Protein Gamma-butyrobetaine hydroxylase (GBBH) N-terminal domain [310810] (1 species)
  7. 3012221Species Human (Homo sapiens) [TaxId:9606] [311076] (1 PDB entry)
  8. 3012222Domain d3n6wa1: 3n6w A:1-95 [306018]
    Other proteins in same PDB: d3n6wa2, d3n6wa3
    complexed with so4, zn

Details for d3n6wa1

PDB Entry: 3n6w (more details), 2 Å

PDB Description: Crystal structure of human gamma-butyrobetaine hydroxylase
PDB Compounds: (A:) Gamma-butyrobetaine dioxygenase

SCOPe Domain Sequences for d3n6wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n6wa1 d.392.1.1 (A:1-95) Gamma-butyrobetaine hydroxylase (GBBH) N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mactiqkaealdgahlmqilwydeeeslypavwlrdncpcsdcyldsakarkllvealdv
nigikglifdrkkvyitwpdehysefqadwlkkrc

SCOPe Domain Coordinates for d3n6wa1:

Click to download the PDB-style file with coordinates for d3n6wa1.
(The format of our PDB-style files is described here.)

Timeline for d3n6wa1: