![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (26 species) |
![]() | Species Canis lupus [TaxId:9615] [311319] (1 PDB entry) |
![]() | Domain d3n48b_: 3n48 B: [306017] Other proteins in same PDB: d3n48a_ automated match to d1fhjb_ complexed with hem, oxy |
PDB Entry: 3n48 (more details), 1.9 Å
SCOPe Domain Sequences for d3n48b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n48b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Canis lupus [TaxId: 9615]} vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk eftpqvqaayqkvvagvanalahkyh
Timeline for d3n48b_: