Lineage for d3n3vc_ (3n3v C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2866774Protein CDC42 [52619] (2 species)
  7. 2866775Species Human (Homo sapiens) [TaxId:9606] [52620] (34 PDB entries)
  8. 2866784Domain d3n3vc_: 3n3v C: [306014]
    automated match to d2dfkd_
    complexed with amp, gdp, mg, so4

Details for d3n3vc_

PDB Entry: 3n3v (more details), 2.3 Å

PDB Description: Crystal Structure of IbpAFic2-H3717A in complex with adenylylated Cdc42
PDB Compounds: (C:) Cell division control protein 42 homolog

SCOPe Domain Sequences for d3n3vc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n3vc_ c.37.1.8 (C:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
tikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtagqe
dydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlrdd
pstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale

SCOPe Domain Coordinates for d3n3vc_:

Click to download the PDB-style file with coordinates for d3n3vc_.
(The format of our PDB-style files is described here.)

Timeline for d3n3vc_: