Lineage for d3n2ec1 (3n2e C:1-162)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872033Species Helicobacter pylori [TaxId:85962] [311198] (5 PDB entries)
  8. 2872039Domain d3n2ec1: 3n2e C:1-162 [306012]
    Other proteins in same PDB: d3n2ea2, d3n2ec2
    automated match to d4y0aa_
    complexed with osa, tla

Details for d3n2ec1

PDB Entry: 3n2e (more details), 2.53 Å

PDB Description: Crystal structure of Helicobactor pylori shikimate kinase in complex with NSC162535
PDB Compounds: (C:) Shikimate kinase

SCOPe Domain Sequences for d3n2ec1:

Sequence, based on SEQRES records: (download)

>d3n2ec1 c.37.1.0 (C:1-162) automated matches {Helicobacter pylori [TaxId: 85962]}
mqhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelgednfrmfe
knlidelktlktphvistgggivmhenlkglgttfylkmdfetlikrlnqkerakrplln
nltqakelfekrqalyeknasfiidargglnnslkqvlqfia

Sequence, based on observed residues (ATOM records): (download)

>d3n2ec1 c.37.1.0 (C:1-162) automated matches {Helicobacter pylori [TaxId: 85962]}
mqhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelgednfrmfe
knlidelktlktphvistgggivmhenlkglgttfylkmdalyeknasfiidargglnns
lkqvlqfia

SCOPe Domain Coordinates for d3n2ec1:

Click to download the PDB-style file with coordinates for d3n2ec1.
(The format of our PDB-style files is described here.)

Timeline for d3n2ec1: