SCOPe 2.08: Domain d3n2ea1: 3n2e A:1-162

Lineage for d3n2ea1 (3n2e A:1-162)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [311198] (5 PDB entries)

8. Domain d3n2ea1: 3n2e A:1-162 [306009]
   Other proteins in same PDB: d3n2ea2, d3n2ec2
   automated match to d4y0aa_
   complexed with osa, tla

Details for d3n2ea1

PDB Entry: 3n2e, 2.53 Å

PDB Description: Crystal structure of Helicobactor pylori shikimate kinase in complex with NSC162535

PDB Compounds: (A:) Shikimate kinase

SCOPe Domain Sequences for d3n2ea1:

Sequence; same for both SEQRES and ATOM records:

>d3n2ea1 c.37.1.0 (A:1-162) automated matches {Helicobacter pylori [TaxId: 85962]}
mqhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelgednfrmfe
knlidelktlktphvistgggivmhenlkglgttfylkmdfetlikrlnqkerakrplln
nltqakelfekrqalyeknasfiidargglnnslkqvlqfia

Timeline for d3n2ea1:

• d3n2ea1 first appeared in SCOPe 2.06
  
• d3n2ea1 appears in SCOPe 2.07