![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [311318] (2 PDB entries) |
![]() | Domain d3mzsd_: 3mzs D: [306006] automated match to d3k9va_ complexed with hc9, hem, ipa |
PDB Entry: 3mzs (more details), 2.5 Å
SCOPe Domain Sequences for d3mzsd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mzsd_ a.104.1.0 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]} tprpyseipspgdngwlnlyhfwrekgsqrihfrhienfqkygpiyreklgnlesvyiih pedvahlfkfegsyperydippwlayhryyqkpigvlfkksgtwkkdrvvlntevmapea iknfipllnpvsqdfvsllhkrikqqgsgkfvgdikedlfhfafesitnvmfgerlgmle etvnpeaqkfidavykmfhtsvpllnvppelyrlfrtktwrdhvaawdtifnkaekytei fyqdlrrktefrnypgilycllksekmlledvkanitemlaggvnttsmtlqwhlyemar slnvqemlreevlnarrqaegdiskmlqmvpllkasiketlrlhpisvtlqrypesdlvl qdylipaktlvqvaiyamgrdpaffsspdkfdptrwlskdkdlihfrnlgfgwgvrqcvg rriaelemtlflihilenfkvemqhigdvdtifnliltpdkpiflvfrpf
Timeline for d3mzsd_: