Lineage for d3mzsd_ (3mzs D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005564Species Cow (Bos taurus) [TaxId:9913] [311318] (2 PDB entries)
  8. 2005568Domain d3mzsd_: 3mzs D: [306006]
    automated match to d3k9va_
    complexed with hc9, hem, ipa

Details for d3mzsd_

PDB Entry: 3mzs (more details), 2.5 Å

PDB Description: Crystal Structure of Cytochrome P450 CYP11A1 in complex with 22-hydroxy-cholesterol
PDB Compounds: (D:) Cholesterol side-chain cleavage enzyme

SCOPe Domain Sequences for d3mzsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mzsd_ a.104.1.0 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tprpyseipspgdngwlnlyhfwrekgsqrihfrhienfqkygpiyreklgnlesvyiih
pedvahlfkfegsyperydippwlayhryyqkpigvlfkksgtwkkdrvvlntevmapea
iknfipllnpvsqdfvsllhkrikqqgsgkfvgdikedlfhfafesitnvmfgerlgmle
etvnpeaqkfidavykmfhtsvpllnvppelyrlfrtktwrdhvaawdtifnkaekytei
fyqdlrrktefrnypgilycllksekmlledvkanitemlaggvnttsmtlqwhlyemar
slnvqemlreevlnarrqaegdiskmlqmvpllkasiketlrlhpisvtlqrypesdlvl
qdylipaktlvqvaiyamgrdpaffsspdkfdptrwlskdkdlihfrnlgfgwgvrqcvg
rriaelemtlflihilenfkvemqhigdvdtifnliltpdkpiflvfrpf

SCOPe Domain Coordinates for d3mzsd_:

Click to download the PDB-style file with coordinates for d3mzsd_.
(The format of our PDB-style files is described here.)

Timeline for d3mzsd_:

  • d3mzsd_ is new in SCOPe 2.06-stable