Lineage for d1djqa3 (1djq A:341-489,A:646-729)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21132Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
  4. 21133Superfamily c.4.1: Nucleotide-binding domain [51971] (2 families) (S)
  5. 21134Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (3 proteins)
  6. 21152Protein Trimethylamine dehydrogenase, middle domain [51973] (1 species)
  7. 21153Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51974] (3 PDB entries)
  8. 21156Domain d1djqa3: 1djq A:341-489,A:646-729 [30600]
    Other proteins in same PDB: d1djqa1, d1djqa2, d1djqb1, d1djqb2

Details for d1djqa3

PDB Entry: 1djq (more details), 2.2 Å

PDB Description: structural and biochemical characterization of recombinant c30a mutant of trimethylamine dehydrogenase from methylophilus methylotrophus (sp. w3a1)

SCOP Domain Sequences for d1djqa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1}
dirvcigcnvcisrweiggppmictqnatageeyrrgwhpekfrqtknkdsvlivgagps
gseaarvlmesgytvhltdtaekigghlnqvaalpglgewsyhrdyretqitkllkknke
sqlalgqkpmtaddvlqygadkviiatgaXsectlwnelkaresewaendikgiyligda
eaprliadatftghrvareieeanpqiaipykretiawgtphmpggnfkieykv

SCOP Domain Coordinates for d1djqa3:

Click to download the PDB-style file with coordinates for d1djqa3.
(The format of our PDB-style files is described here.)

Timeline for d1djqa3: