Lineage for d3mx5b1 (3mx5 B:8-338)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017049Fold a.300: Arenavirus nucleocapsid protein-like [310566] (1 superfamily)
  4. 2017050Superfamily a.300.1: Arenavirus nucleocapsid protein N-terminal domain-like [310594] (1 family) (S)
    N-terminal half of Pfam PF00843
  5. 2017051Family a.300.1.1: Arenavirus nucleocapsid protein N-terminal domain [310641] (2 protein domains)
  6. 2017052Protein Lassa virus (LASV) nucleoprotein (NP), N-terminal domain [310782] (1 species)
  7. 2017053Species Lassa virus Josiah [TaxId:11622] [311038] (3 PDB entries)
  8. 2017061Domain d3mx5b1: 3mx5 B:8-338 [305999]
    Other proteins in same PDB: d3mx5a2, d3mx5b2, d3mx5c2
    automated match to d3mwpa2
    complexed with utp, zn

Details for d3mx5b1

PDB Entry: 3mx5 (more details), 1.9 Å

PDB Description: Lassa fever virus nucleoprotein complexed with UTP
PDB Compounds: (B:) nucleoprotein

SCOPe Domain Sequences for d3mx5b1:

Sequence, based on SEQRES records: (download)

>d3mx5b1 a.300.1.1 (B:8-338) Lassa virus (LASV) nucleoprotein (NP), N-terminal domain {Lassa virus Josiah [TaxId: 11622]}
ksflwtqslrrelsgycsniklqvvkdaqallhgldfsevsnvqrlmrkerrddndlkrl
rdlnqavnnlvelkstqqksilrvgtltsddllilaadleklkskvirterplsagvymg
nlssqqldqrrallnmigmsggnqgaragrdgvvrvwdvknaellnnqfgtmpsltlacl
tkqgqvdlndavqaltdlgliytakypntsdldrltqshpilnmidtkksslnisgynfs
lgaavkagacmldggnmletikvspqtmdgilksilkvkkalgmfisdtpgernpyenil
ykiclsgdgwpyiasrtsitgrawentvvdl

Sequence, based on observed residues (ATOM records): (download)

>d3mx5b1 a.300.1.1 (B:8-338) Lassa virus (LASV) nucleoprotein (NP), N-terminal domain {Lassa virus Josiah [TaxId: 11622]}
ksflwtqslrrelsgycsniklqvvkdaqallhgldfsevsnvqrlmrkerrddndlkrl
rdlnqavnnlvelkstqqksilrvgtltsddllilaadleklkskvirterplsagvymg
nlssqqldqrrallnmigmsdgvvrvwdvknaellnnqfgtmpsltlacltkqgqvdlnd
avqaltdlgliytakypntsdldrltqshpilnmidtkksslnisgynfslgaavkagac
mldggnmletikvspqtmdgilksilkvkkalgmfisdtpgernpyenilykiclsgdgw
pyiasrtsitgrawentvvdl

SCOPe Domain Coordinates for d3mx5b1:

Click to download the PDB-style file with coordinates for d3mx5b1.
(The format of our PDB-style files is described here.)

Timeline for d3mx5b1:

  • d3mx5b1 is new in SCOPe 2.06-stable