![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
![]() | Protein Arenavirus nucleoprotein C-terminal domain [310781] (1 species) C-terminal half of Pfam PF00843 |
![]() | Species Lassa virus Josiah [TaxId:11622] [311037] (3 PDB entries) |
![]() | Domain d3mx2c2: 3mx2 C:364-561 [305996] Other proteins in same PDB: d3mx2a1, d3mx2b1, d3mx2c1 automated match to d3mwpa1 complexed with ttp, zn |
PDB Entry: 3mx2 (more details), 1.98 Å
SCOPe Domain Sequences for d3mx2c2:
Sequence, based on SEQRES records: (download)
>d3mx2c2 c.55.3.5 (C:364-561) Arenavirus nucleoprotein C-terminal domain {Lassa virus Josiah [TaxId: 11622]} gltysqlmtlkdamlqldpnaktwmdiegrpedpveialyqpssgcyihffreptdlkqf kqdakyshgidvtdlfatqpgltsavidalprnmvitcqgsddirkllesqgrkdiklid ialsktdsrkyenavwdqykdlchmhtgvvvekkkrggkeeitphcalmdcimfdaavsg glntsvlravlprdmvfr
>d3mx2c2 c.55.3.5 (C:364-561) Arenavirus nucleoprotein C-terminal domain {Lassa virus Josiah [TaxId: 11622]} gltysqlmtlkdamlqldpnaktwmdiegrpedpveialyqpssgcyihffreptdlkqf kqdakyshgidvtdlfatqpgltsavidalprnmvitcqgsddirkllesqgrkdiklid ialsktdsrkyenavwdqykdlchmhtgvvvekkkeeitphcalmdcimfdaavsgglnt svlravlprdmvfr
Timeline for d3mx2c2:
![]() Domains from other chains: (mouse over for more information) d3mx2a1, d3mx2a2, d3mx2b1, d3mx2b2 |