SCOPe 2.07: Domain d3mx2c2: 3mx2 C:364-561

Lineage for d3mx2c2 (3mx2 C:364-561)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 protein domains)
   contains Pfam PF00929

6. Protein Arenavirus nucleoprotein C-terminal domain [310781] (1 species)
   C-terminal half of Pfam PF00843

7. Species Lassa virus Josiah [TaxId:11622] [311037] (3 PDB entries)

8. Domain d3mx2c2: 3mx2 C:364-561 [305996]
   Other proteins in same PDB: d3mx2a1, d3mx2b1, d3mx2c1
   automated match to d3mwpa1
   complexed with ttp, zn

Details for d3mx2c2

PDB Entry: 3mx2, 1.98 Å

PDB Description: Lassa fever virus Nucleoprotein complexed with dTTP

PDB Compounds: (C:) nucleoprotein

SCOPe Domain Sequences for d3mx2c2:

Sequence, based on SEQRES records:

>d3mx2c2 c.55.3.5 (C:364-561) Arenavirus nucleoprotein C-terminal domain {Lassa virus Josiah [TaxId: 11622]}
gltysqlmtlkdamlqldpnaktwmdiegrpedpveialyqpssgcyihffreptdlkqf
kqdakyshgidvtdlfatqpgltsavidalprnmvitcqgsddirkllesqgrkdiklid
ialsktdsrkyenavwdqykdlchmhtgvvvekkkrggkeeitphcalmdcimfdaavsg
glntsvlravlprdmvfr

Sequence, based on observed residues (ATOM records):

>d3mx2c2 c.55.3.5 (C:364-561) Arenavirus nucleoprotein C-terminal domain {Lassa virus Josiah [TaxId: 11622]}
gltysqlmtlkdamlqldpnaktwmdiegrpedpveialyqpssgcyihffreptdlkqf
kqdakyshgidvtdlfatqpgltsavidalprnmvitcqgsddirkllesqgrkdiklid
ialsktdsrkyenavwdqykdlchmhtgvvvekkkeeitphcalmdcimfdaavsgglnt
svlravlprdmvfr

Timeline for d3mx2c2:

• d3mx2c2 first appeared in SCOPe 2.06