Lineage for d3mx2c2 (3mx2 C:364-561)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886484Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2886485Protein Arenavirus nucleoprotein C-terminal domain [310781] (1 species)
    C-terminal half of Pfam PF00843
  7. 2886486Species Lassa virus Josiah [TaxId:11622] [311037] (3 PDB entries)
  8. 2886492Domain d3mx2c2: 3mx2 C:364-561 [305996]
    Other proteins in same PDB: d3mx2a1, d3mx2b1, d3mx2c1
    automated match to d3mwpa1
    complexed with ttp, zn

Details for d3mx2c2

PDB Entry: 3mx2 (more details), 1.98 Å

PDB Description: Lassa fever virus Nucleoprotein complexed with dTTP
PDB Compounds: (C:) nucleoprotein

SCOPe Domain Sequences for d3mx2c2:

Sequence, based on SEQRES records: (download)

>d3mx2c2 c.55.3.5 (C:364-561) Arenavirus nucleoprotein C-terminal domain {Lassa virus Josiah [TaxId: 11622]}
gltysqlmtlkdamlqldpnaktwmdiegrpedpveialyqpssgcyihffreptdlkqf
kqdakyshgidvtdlfatqpgltsavidalprnmvitcqgsddirkllesqgrkdiklid
ialsktdsrkyenavwdqykdlchmhtgvvvekkkrggkeeitphcalmdcimfdaavsg
glntsvlravlprdmvfr

Sequence, based on observed residues (ATOM records): (download)

>d3mx2c2 c.55.3.5 (C:364-561) Arenavirus nucleoprotein C-terminal domain {Lassa virus Josiah [TaxId: 11622]}
gltysqlmtlkdamlqldpnaktwmdiegrpedpveialyqpssgcyihffreptdlkqf
kqdakyshgidvtdlfatqpgltsavidalprnmvitcqgsddirkllesqgrkdiklid
ialsktdsrkyenavwdqykdlchmhtgvvvekkkeeitphcalmdcimfdaavsgglnt
svlravlprdmvfr

SCOPe Domain Coordinates for d3mx2c2:

Click to download the PDB-style file with coordinates for d3mx2c2.
(The format of our PDB-style files is described here.)

Timeline for d3mx2c2: