Lineage for d1djnb3 (1djn B:341-489,B:646-729)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2458575Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2458576Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 2458577Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)
  6. 2458634Protein Trimethylamine dehydrogenase, middle domain [51973] (1 species)
  7. 2458635Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51974] (5 PDB entries)
  8. 2458643Domain d1djnb3: 1djn B:341-489,B:646-729 [30599]
    Other proteins in same PDB: d1djna1, d1djna2, d1djnb1, d1djnb2
    complexed with adp, fmn, sf4

Details for d1djnb3

PDB Entry: 1djn (more details), 2.2 Å

PDB Description: structural and biochemical characterization of recombinant wild type trimethylamine dehydrogenase from methylophilus methylotrophus (sp. w3a1)
PDB Compounds: (B:) trimethylamine dehydrogenase

SCOPe Domain Sequences for d1djnb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djnb3 c.4.1.1 (B:341-489,B:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
dirvcigcnvcisrweiggppmictqnatageeyrrgwhpekfrqtknkdsvlivgagps
gseaarvlmesgytvhltdtaekigghlnqvaalpglgewsyhrdyretqitkllkknke
sqlalgqkpmtaddvlqygadkviiatgaXsectlwnelkaresewaendikgiyligda
eaprliadatftghrvareieeanpqiaipykretiawgtphmpggnfkieykv

SCOPe Domain Coordinates for d1djnb3:

Click to download the PDB-style file with coordinates for d1djnb3.
(The format of our PDB-style files is described here.)

Timeline for d1djnb3: