SCOP 1.69: Domain d1djnb3: 1djn B:341-489,B:646-729

Lineage for d1djnb3 (1djn B:341-489,B:646-729)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families)
   this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains

5. Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)

6. Protein Trimethylamine dehydrogenase, middle domain [51973] (1 species)

7. Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51974] (5 PDB entries)

8. Domain d1djnb3: 1djn B:341-489,B:646-729 [30599]
   Other proteins in same PDB: d1djna1, d1djna2, d1djnb1, d1djnb2

Details for d1djnb3

PDB Entry: 1djn, 2.2 Å

PDB Description: structural and biochemical characterization of recombinant wild type trimethylamine dehydrogenase from methylophilus methylotrophus (sp. w3a1)

SCOP Domain Sequences for d1djnb3:

Sequence; same for both SEQRES and ATOM records:

>d1djnb3 c.4.1.1 (B:341-489,B:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1}
dirvcigcnvcisrweiggppmictqnatageeyrrgwhpekfrqtknkdsvlivgagps
gseaarvlmesgytvhltdtaekigghlnqvaalpglgewsyhrdyretqitkllkknke
sqlalgqkpmtaddvlqygadkviiatgaXsectlwnelkaresewaendikgiyligda
eaprliadatftghrvareieeanpqiaipykretiawgtphmpggnfkieykv

Timeline for d1djnb3:

• d1djnb3 first appeared (with stable ids) in SCOP 1.55
  
• d1djnb3 appears in SCOP 1.67
  
• d1djnb3 appears in SCOP 1.71
  
• d1djnb3 appears in the current release, SCOPe 2.08