SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3mwpa1 (3mwp A:364-561)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124334Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 protein domains)
    contains Pfam PF00929
  6. 2124335Protein Arenavirus nucleoprotein C-terminal domain [310781] (1 species)
    C-terminal half of Pfam PF00843
  7. 2124336Species Lassa virus Josiah [TaxId:11622] [311037] (3 PDB entries)
  8. 2124337Domain d3mwpa1: 3mwp A:364-561 [305985]
    Other proteins in same PDB: d3mwpa2, d3mwpb2, d3mwpc2
    complexed with zn

Details for d3mwpa1

PDB Entry: 3mwp (more details), 1.79 Å

PDB Description: Nucleoprotein structure of lassa fever virus
PDB Compounds: (A:) nucleoprotein

SCOPe Domain Sequences for d3mwpa1:

Sequence, based on SEQRES records: (download)

>d3mwpa1 c.55.3.5 (A:364-561) Arenavirus nucleoprotein C-terminal domain {Lassa virus Josiah [TaxId: 11622]}
gltysqlmtlkdamlqldpnaktwmdiegrpedpveialyqpssgcyihffreptdlkqf
kqdakyshgidvtdlfatqpgltsavidalprnmvitcqgsddirkllesqgrkdiklid
ialsktdsrkyenavwdqykdlchmhtgvvvekkkrggkeeitphcalmdcimfdaavsg
glntsvlravlprdmvfr

Sequence, based on observed residues (ATOM records): (download)

>d3mwpa1 c.55.3.5 (A:364-561) Arenavirus nucleoprotein C-terminal domain {Lassa virus Josiah [TaxId: 11622]}
gltysqlmtlkdamlqldpnaktwmdiegrpedpveialyqpssgcyihffreptdlkqf
kqdakyshgidvtdlfatqpgltsavidalprnmvitcqgsddirkllesqgrkdiklid
ialsktdsrkyenavwdqykdlchmhtgvvvekkeeitphcalmdcimfdaavsgglsvl
ravlprdmvfr

SCOPe Domain Coordinates for d3mwpa1:

Click to download the PDB-style file with coordinates for d3mwpa1.
(The format of our PDB-style files is described here.)

Timeline for d3mwpa1:

  • d3mwpa1 is new in SCOPe 2.06-stable