Lineage for d3movb_ (3mov B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040442Superfamily h.1.20: Intermediate filament protein, coiled coil region [64593] (2 families) (S)
  5. 3040462Family h.1.20.0: automated matches [254316] (1 protein)
    not a true family
  6. 3040463Protein automated matches [254726] (1 species)
    not a true protein
  7. 3040464Species Human (Homo sapiens) [TaxId:9606] [256106] (6 PDB entries)
  8. 3040468Domain d3movb_: 3mov B: [305970]
    automated match to d1gk4a_

Details for d3movb_

PDB Entry: 3mov (more details), 2.4 Å

PDB Description: Crystal Structure of Human Lamin-B1 Coil 2 Segment
PDB Compounds: (B:) Lamin-B1

SCOPe Domain Sequences for d3movb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3movb_ h.1.20.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esracleriqeledllakekdnsrrmltdkeremaeirdqmqqqlndyeqlldvklaldm
eisayrklleg

SCOPe Domain Coordinates for d3movb_:

Click to download the PDB-style file with coordinates for d3movb_.
(The format of our PDB-style files is described here.)

Timeline for d3movb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3mova_