SCOPe 2.08: Domain d3mova_: 3mov A:

Lineage for d3mova_ (3mov A:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.20: Intermediate filament protein, coiled coil region [64593] (2 families)

5. Family h.1.20.0: automated matches [254316] (1 protein)
   not a true family

6. Protein automated matches [254726] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256106] (6 PDB entries)

8. Domain d3mova_: 3mov A: [305969]
   automated match to d1gk4a_

Details for d3mova_

PDB Entry: 3mov, 2.4 Å

PDB Description: Crystal Structure of Human Lamin-B1 Coil 2 Segment

PDB Compounds: (A:) Lamin-B1

SCOPe Domain Sequences for d3mova_:

Sequence; same for both SEQRES and ATOM records:

>d3mova_ h.1.20.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkesracleriqeledllakekdnsrrmltdkeremaeirdqmqqqlndyeqlldvklal
dmeisayrkllegee

Timeline for d3mova_:

• d3mova_ first appeared in SCOPe 2.06
  
• d3mova_ appears in SCOPe 2.07